Ictalurus punctatus (channel catfish): 108278352 Help Entry 108278352         CDS       T04658                                  Symbol hmgb1b Name (RefSeq) high mobility group protein B1b   KO K10802   high mobility group protein B1 Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu03410   Base excision repair ipu04140   Autophagy - animal ipu04217   Necroptosis Brite KEGG Orthology (KO) [BR:ipu00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     108278352 (hmgb1b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108278352 (hmgb1b)   09143 Cell growth and death    04217 Necroptosis     108278352 (hmgb1b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ipu03036]     108278352 (hmgb1b)    03400 DNA repair and recombination proteins [BR:ipu03400]     108278352 (hmgb1b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     108278352 (hmgb1b) Chromosome and associated proteins [BR:ipu03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     108278352 (hmgb1b) DNA repair and recombination proteins [BR:ipu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      108278352 (hmgb1b)    MMR (mismatch excision repair)     Other MMR factors      108278352 (hmgb1b) Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108278352 (hmgb1b) SSDB OrthologParalogGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_WDHD1 HMG_box_5 Motif Other DBs NCBI-GeneID:  108278352 NCBI-ProteinID:  XP_017347169 Ensembl:  ENSIPUG00000012743 UniProt:  A0A2D0SXX1 LinkDB All DBs Position 17:24541336..24544877 Genome browser AA seq 198 aa AA seqDB search MVKDPRKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSPKEKSKFE DMAKQDKVRYEREMKNYIPPKGEKKKRFKDPNAPKRPPSAFFIFCGDYRPKIKGENPGLT IGDIAKKLGEMWNSSSAEVKQPYEKKAAKLKEKYDKDIAAYRTKGIAGLSKSDPGDDDDE EEDEEEDDEDDDDDEDDE NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggttaaggatccaaggaagcctcgaggaaaaatgtcctcttatgcatattttgtgcaa acctgtcgtgaggagcacaagaaaaagcacccggaagcttctgtcaacttctctgaattc tccaagaagtgctcagagcgatggaagacaatgtcacccaaagagaagagcaagtttgag gacatggcgaagcaggataaggtccgttatgagagagagatgaagaactacatccctccc aagggggagaagaagaagcgctttaaggaccccaatgcccccaagagacctccgtcagca ttcttcattttctgtggtgactatcgccccaagatcaagggtgagaatccgggcctgact attggagacatagccaagaagcttggggagatgtggaacagctcatcagcagaggtgaag cagccttatgagaagaaagctgccaagttgaaggagaagtatgacaaggatattgctgca taccgcacaaaggggattgcaggcctgtccaagtcagatcctggtgacgacgatgacgag gaagaggacgaggaggaagatgatgaggacgatgatgatgatgaggatgatgagtag

DBGET integrated database retrieval system