Ictalurus punctatus (channel catfish): 108280902 Help Entry 108280902         CDS       T04658                                  Symbol elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ipu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     108280902 (elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ipu04121]     108280902 (elob)    03400 DNA repair and recombination proteins [BR:ipu03400]     108280902 (elob) Ubiquitin system [BR:ipu04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      108280902 (elob)    Cul5 complex      108280902 (elob) DNA repair and recombination proteins [BR:ipu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      108280902 (elob) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  108280902 NCBI-ProteinID:  XP_017351895 Ensembl:  ENSIPUG00000008023 UniProt:  A0A2D0TB46 LinkDB All DBs Position 2:complement(39305032..39313497) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDMMLEDSKTLGDC GFTNQTARPQAPATVGLAFRISDDAFEPLRVDAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctgatgatccgacgtcacaagaccaccatcttcacagacgccaaggag tcgaccactgtgtacgagctgaagcgcatcgtggaggggatcctgaagagagcgcccgag gagcagagactctacaaggacgacatgatgttagaagacagtaagacgctgggagactgc ggattcacaaaccagacagcaagacctcaggctccagctacagtggggctggccttccgt atcagtgacgacgcgttcgagccgctgcgtgtggacgcgttctccagtccccccgagctg ccggacgtgatgaagccccaggactcgggcagcacggccaacgagcaggctgtgcagtga

DBGET integrated database retrieval system