Ictalurus punctatus (channel catfish): 124627526 Help Entry 124627526         CDS       T04658                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu03082   ATP-dependent chromatin remodeling ipu04217   Necroptosis Brite KEGG Orthology (KO) [BR:ipu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     124627526  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     124627526  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ipu03036]     124627526   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     124627526 Chromosome and associated proteins [BR:ipu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     124627526 Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124627526 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  124627526 NCBI-ProteinID:  XP_047009766 UniProt:  W5UK39 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAVKTK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagtggcagaggaaaaactggcggaaaagctagagctaaggccaagactcgttcatcc agggctggacttcagtttcccgtgggacgtgtgcacaggcttctgcgtaaaggcaactat gccgagcgcgtcggtgccggcgctccggtctacctggccgcagtgttggagtatctgacc gctgagatcctggagttggccggtaacgccgcccgtgataacaagaagactcgtatcatt ccccgccacttacagctcgccgtgcgtaacgacgaggagctgaacaaactgctcggcgga gtgaccatcgctcagggtggtgtgctgcccaacattcaggctgtgcttttgcccaaaaag accgagaaggccgtcaagactaagtaa

DBGET integrated database retrieval system