Ictalurus punctatus (channel catfish): 128629970 Help Entry 128629970         CDS       T04658                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism ipu  Ictalurus punctatus (channel catfish) Brite KEGG Orthology (KO) [BR:ipu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ipu03036]     128629970   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     128629970 Chromosome and associated proteins [BR:ipu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128629970 Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128629970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  128629970 NCBI-ProteinID:  XP_053534498 UniProt:  A0A9F7TGJ8 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MPDPAKTAPKKGSKKAVTKTAGKGGKKRRKSRKESYAIYVYKVLKQRIAGESSRLAHYNK RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcccgatccagccaagaccgcgcccaagaagggatcaaagaaagccgtgaccaagacg gccggcaaaggaggcaagaagcgcagaaaatcccggaaggagagctatgccatctacgtg tacaaggttctcaagcagcgcatcgccggtgagtcttctcgtctggctcattacaacaag cgctccaccatcacctccagggagatccagaccgccgtgcgcctgttgcttcccggcgag ctggccaagcacgccgtgtccgagggtacaaaagccgtcaccaagtacaccagctccaag taa

DBGET integrated database retrieval system