Ictalurus punctatus (channel catfish): 128634227 Help Entry 128634227         CDS       T04658                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu03082   ATP-dependent chromatin remodeling ipu04217   Necroptosis Brite KEGG Orthology (KO) [BR:ipu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     128634227  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     128634227  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ipu03036]     128634227   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     128634227 Chromosome and associated proteins [BR:ipu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128634227 Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128634227 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  128634227 NCBI-ProteinID:  XP_053540501 UniProt:  W5UK39 LinkDB All DBs Position 12:4189636..4190274 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAVKTK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagtggcagaggaaaaaccggcggaaaagctagagctaaggccaagactcgttcatcc agggctggacttcagttccccgtgggacgtgtgcacaggcttctgcgtaaaggcaactat gccgagcgcgtcggtgccggcgccccagtctatcttgccgcagtgttggagtatctgacc gctgagatcctggagttggccggtaacgccgcccgtgacaacaagaagactcgtatcatt ccccgccacttacagctcgccgtgcgtaacgacgaggagttgaacaaactgctcggcgga gtgaccatcgctcaaggtggtgtgctgcccaacattcaggctgtgcttctgcctaaaaag accgagaaggccgttaagactaagtaa

DBGET integrated database retrieval system