Imperialibacter roseus: RT717_14765
Help
Entry
RT717_14765 CDS
T09469
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
iro
Imperialibacter roseus
Pathway
iro00770
Pantothenate and CoA biosynthesis
iro01100
Metabolic pathways
iro01240
Biosynthesis of cofactors
Module
iro_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
iro00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
RT717_14765 (coaD)
Enzymes [BR:
iro01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
RT717_14765 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Motif
Other DBs
NCBI-ProteinID:
WOK04339
UniProt:
A0ABZ0IH17
LinkDB
All DBs
Position
3558588..3559043
Genome browser
AA seq
151 aa
AA seq
DB search
MPNKTAVFPGSFDPFTLGHFDIVIRSLKLFDEVIIAIGHNSQKKRYFPLETMLSKIESAF
VKYPQVKIVTYDELTADLAKRLGAKVLLRGLRNTTDFEYENSISQVNRYLNDEIETMFLI
TSPKYAPISSTIIREVHKYGGDVKAFLPYEL
NT seq
456 nt
NT seq
+upstream
nt +downstream
nt
atgccaaataaaaccgctgtctttcctggttcattcgaccccttcaccctggggcatttc
gacattgtgataaggagcctgaagctgtttgacgaagtaatcatcgccattggccacaac
agtcagaaaaaaaggtatttcccgcttgagactatgctcagcaagatagaaagtgccttt
gtgaagtatccgcaggtaaaaatagtgacctatgacgagctgaccgcagacctcgccaaa
aggctgggcgctaaagtactactgagaggactccgaaatacaacggactttgaatatgag
aacagtatttcgcaggtaaacaggtacctgaacgacgaaatagaaaccatgtttttgatt
acttcccccaagtacgcccccattagttccaccattatcagggaagtacataaatacggt
ggcgatgtaaaggcctttctgccttacgagttataa
DBGET
integrated database retrieval system