Ixodes scapularis (black-legged tick): 115328519 Help Entry 115328519         CDS       T01131                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism isc  Ixodes scapularis (black-legged tick) Pathway isc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:isc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     115328519  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:isc04121]     115328519    03400 DNA repair and recombination proteins [BR:isc03400]     115328519 Ubiquitin system [BR:isc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      115328519    Cul5 complex      115328519 DNA repair and recombination proteins [BR:isc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      115328519 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD TDP-43_N TBK1_ULD Motif Other DBs NCBI-GeneID:  115328519 NCBI-ProteinID:  XP_029845585 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMVRRKKTTVFLDAKETTSVRELKKMIAGITKVAPENQMLYKDEQCMDDNKMLTEY GLNSSTAKAQAPATVGLAFRDPDSGKFENLDVTPLSSPPELPDVMKPPESQAHEQTVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtatttctcatggtccggaggaagaaaaccaccgtcttcctggacgccaaggag accacctcggtccgggaactgaagaagatgattgcgggcatcaccaaggtcgctcccgaa aaccagatgctctacaaggacgagcagtgcatggacgacaacaaaatgctcaccgagtac gggctcaacagcagcacggccaaggctcaagccccggccaccgtggggctcgcctttcga gatccggactcggggaagttcgagaacctcgacgtgacgccgctgtccagcccgcccgag ctaccggacgtcatgaagccgcccgagtcgcaggcccacgaacaaactgtcgcttga

DBGET integrated database retrieval system