KEGG   Ictidomys tridecemlineatus (thirteen-lined ground squirrel): 101959524
Entry
101959524         CDS       T10664                                 
Name
(RefSeq) LOW QUALITY PROTEIN: cyclin-dependent kinases regulatory subunit 1-like
  KO
K02219  cyclin-dependent kinase regulatory subunit CKS1
Organism
iti  Ictidomys tridecemlineatus (thirteen-lined ground squirrel)
Pathway
iti05200  Pathways in cancer
iti05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:iti00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101959524
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101959524
SSDB
Motif
Pfam: CKS
Other DBs
NCBI-GeneID: 101959524
NCBI-ProteinID: XP_013214823
LinkDB
Position
Unknown
AA seq 82 aa
MVLEACRQSNYVKQIYYSDKYDNKEFKYWHVMLPKDRAKLVPKTHXIXMEESWCQGWVHY
MIHEPELHILLFWQPLPKKPKK
NT seq 249 nt   +upstreamnt  +downstreamnt
atggtgctggaggcctgcaggcaaagcaattatgtcaaacaaatttactattcagacaaa
tatgacaacaaggagttcaagtactggcatgtcatgttgcccaaggacagagccaaactg
gtccctaaaacccactgaatctgaatggaagaatcttggtgtcagggatgggttcattat
atgatccatgaaccagaacttcatatcttgctattttggcagccactacccaagaagcca
aagaaatga

DBGET integrated database retrieval system