Isoptericola variabilis: Isova_2010 Help Entry Isova_2010        CDS       T01520                                  Name (GenBank) glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism iva  Isoptericola variabilis Brite KEGG Orthology (KO) [BR:iva00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Isova_2010 Enzymes [BR:iva01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Isova_2010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_9 Thioredoxin Thioredoxin_2 GST_N Motif Other DBs NCBI-ProteinID:  AEG44746 UniProt:  F6FPL4 LinkDB All DBs Position complement(2171769..2172062) Genome browser AA seq 97 aa AA seqDB search MTERAASDLARPGILTMYGAAWCGDCRRAQRLLDSRGVEYDYVDLVAAPERADDAEALSG RKNIPVLVFPDGDVLVEPADAELGAKLDAVSSAGGLS NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaccgagcgtgccgcgtccgacctcgcccgaccggggatcctcacgatgtacggcgcc gcgtggtgcggcgactgccgccgcgcacagcggctcctcgactcgcgcggcgtcgagtac gactacgtcgacctcgtggccgcgcccgagcgcgccgacgacgccgaggcgctcagcggt cgcaagaacatccctgtgctcgtcttccccgacggcgacgtgctcgtcgagccggccgac gccgagctcggcgccaagctcgacgccgtgtcctccgcgggcgggctgtcgtga

DBGET integrated database retrieval system