Janthinobacterium sp. B9-8: VN23_01710 Help Entry VN23_01710        CDS       T04271                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism jab  Janthinobacterium sp. B9-8 Brite KEGG Orthology (KO) [BR:jab00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:jab03032]     VN23_01710    03036 Chromosome and associated proteins [BR:jab03036]     VN23_01710    03400 DNA repair and recombination proteins [BR:jab03400]     VN23_01710 DNA replication proteins [BR:jab03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     VN23_01710 Chromosome and associated proteins [BR:jab03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     VN23_01710 DNA repair and recombination proteins [BR:jab03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       VN23_01710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AMC33412 UniProt:  A0A0Y0UP03 LinkDB All DBs Position 413734..414021 Genome browser AA seq 95 aa AA seqDB search MKKRELIEAVLRVAEYELPGISKKAVEATLEALGDVTGATLKGGGEVTLPGIGKLAVKHR DARVGRNPRTGEPVQIPAKKALKYTPLKAIKDAVA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaagaaaagagaactcatcgaagccgtactaagagttgcagagtacgagttgccaggt atttctaaaaaggcggtagaagccactctggaagcactgggcgatgtcaccggcgcaacc ctcaagggtggtggtgaagtgactctgccaggaatcggcaaattagcagtcaaacaccgc gatgcacgtgttggccgcaacccaagaacgggtgagccagtgcaaattcccgctaagaaa gcattaaaatacaccccgcttaaagccattaaagatgcggtcgcttaa

DBGET integrated database retrieval system