Janthinobacterium sp. B9-8: VN23_07110 Help Entry VN23_07110        CDS       T04271                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jab  Janthinobacterium sp. B9-8 Pathway jab01100   Metabolic pathways jab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VN23_07110    00074 Mycolic acid biosynthesis     VN23_07110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VN23_07110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  AMC34385 UniProt:  A0A0X8GKR7 LinkDB All DBs Position 1577944..1578201 Genome browser AA seq 85 aa AA seqDB search MTKQETFERLSAILQETFDTEASKITPEARLYEDLDIDSIDAVDLIVKLKPIAGKRLHPD AFKAVRTLQDVVDALYELMQEKSAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccaagcaagaaacgttcgaacgtcttagtgctattttgcaagaaacttttgatacc gaagccagcaaaatcacccctgaagcacgcctgtacgaagatttagatatcgacagcatc gatgcggttgatctgatcgtcaaacttaagcccatagctggtaaacgcttacatcccgat gcgtttaaagccgtgcgtaccttgcaagatgtcgtcgatgcactctatgagctgatgcaa gaaaaatctgcagcctaa

DBGET integrated database retrieval system