Janthinobacterium sp. B9-8: VN23_16645 Help Entry VN23_16645        CDS       T04271                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism jab  Janthinobacterium sp. B9-8 Pathway jab02020   Two-component system jab02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:jab00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     VN23_16645  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     VN23_16645  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:jab02035]     VN23_16645 Bacterial motility proteins [BR:jab02035]  Flagellar system   Flagellar assembly proteins    Others     VN23_16645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AMC36106 UniProt:  A0A109RWA9 LinkDB All DBs Position complement(3689677..3689931) Genome browser AA seq 84 aa AA seqDB search MRINSNRSEAIITSTPASPVAKPAAHKMADATSTLGIAKQALQAGPEIDMAKVQAIRDAL LRGEINFDADKVAGLMQKYHGGLA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcgtatcaactctaatcgaagcgaagctattatcacctccacccctgcaagccctgtg gctaagcccgctgcgcataaaatggcagatgcaacttctactcttggcatcgctaaacaa gcactgcaagctgggccagagatcgatatggccaaggtgcaggcaattcgtgatgctttg ctgcgtggcgagattaattttgatgcagataaagtggcaggcctaatgcagaaatatcat ggcgggcttgcttga

DBGET integrated database retrieval system