Janthinobacterium aestuarii: OPV09_22270 Help Entry OPV09_22270       CDS       T11009                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jae  Janthinobacterium aestuarii Pathway jae01100   Metabolic pathways jae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OPV09_22270    00074 Mycolic acid biosynthesis     OPV09_22270   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OPV09_22270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding HalOD1 CagD Motif Other DBs NCBI-ProteinID:  WWO45400 UniProt:  A0ABZ2GJV5 LinkDB All DBs Position complement(4943327..4943602) Genome browser AA seq 91 aa AA seqDB search MVDMSAMSRDELYAWVVQLLAEMFELDPAALTPQSNLYAELDIDSIDAVDLAVKLKQLTG KRLQPEVFKTIRTIDDVVEALRAMSVSEQAA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggtagatatgagcgcaatgagccgcgatgaactgtacgcatgggtggtgcagctgctg gccgaaatgttcgagctcgatccggcggcgctgacgccgcaatcgaatctgtacgccgaa ctcgatatcgacagcatcgacgcggtcgacctggcggtcaagctgaagcagctgacgggc aagcgcctgcagccggaagtattcaagaccatccgcacgatcgacgatgtggtcgaagcg ctgcgcgcgatgtcggtgtcggaacaggcggcgtaa

DBGET integrated database retrieval system