Janthinobacterium agaricidamnosum: GJA_1617 Help Entry GJA_1617          CDS       T03157                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jag  Janthinobacterium agaricidamnosum Pathway jag00998   Biosynthesis of various antibiotics jag01100   Metabolic pathways jag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GJA_1617 (acpP)    00074 Mycolic acid biosynthesis     GJA_1617 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GJA_1617 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  CDG82261 UniProt:  W0V306 LinkDB All DBs Position 1778701..1778940 Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKIESSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcggatatcgaacaacgcgttaagaaaatcgtcgctgagcaactgggcgttgcagaa gcagacatcaaaatcgaatcctccttcgtcgacgacctcggcgcggactccctggacacc gtcgaactggtgatggccctggaagacgaattcgaaatggaaatccctgacgaacaagct gaaaagatcaccaccgtgcaacaggctatcgactacgccactgcacacgtcaaggcctaa

DBGET integrated database retrieval system