Janthinobacterium agaricidamnosum: GJA_1944 Help Entry GJA_1944          CDS       T03157                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism jag  Janthinobacterium agaricidamnosum Pathway jag00998   Biosynthesis of various antibiotics jag01100   Metabolic pathways jag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GJA_1944    00074 Mycolic acid biosynthesis     GJA_1944   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GJA_1944 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  CDG82580 UniProt:  W0V4R5 LinkDB All DBs Position complement(2128237..2128461) Genome browser AA seq 74 aa AA seqDB search MQEFFDGLAEILEIDVAQVAPALKLADYAWDSLAIISTIALADDVFDQMLDGKALAACQS VADIVALIEPVKQA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgcaagaatttttcgacggcctggccgagatcctggaaatcgacgtggcgcaagtggcg ccggccctgaaactggccgattacgcctgggattcgctggccatcatttccaccatcgcg ctggcagacgacgtattcgatcaaatgctcgacggcaaagcgctggccgcttgccagagc gtggccgatatcgtcgcgctgatcgagccggtcaagcaggcttga

DBGET integrated database retrieval system