Janthinobacterium agaricidamnosum: GJA_3880 Help Entry GJA_3880          CDS       T03157                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism jag  Janthinobacterium agaricidamnosum Brite KEGG Orthology (KO) [BR:jag00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:jag03110]     GJA_3880 (grxC) Chaperones and folding catalysts [BR:jag03110]  Protein folding catalysts   Protein disulfide isomerase    GJA_3880 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  CDG84491 UniProt:  W0V9E2 LinkDB All DBs Position 4199669..4199929 Genome browser AA seq 86 aa AA seqDB search MSNLSSHVTVYSSNGCGYCAMAKKLLAGKGVTPTEINIDSDRGKMAEMMARSGRRTVPQI FIGEYHVGGFDDLLALDRQGRLEPML NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcaatctgtcgagccacgttaccgtgtacagcagcaatggctgcgggtattgcgca atggccaagaaattattggcgggcaaaggcgtgacgccgactgaaatcaatatcgacagc gaccgcggcaaaatggcggaaatgatggcgcgctccggccgccgcaccgtgccgcagatt ttcatcggcgaataccatgtcggcggcttcgacgacttgctggcgctggaccgccagggc cggcttgagcctatgctgtga

DBGET integrated database retrieval system