Janthinobacterium sp. 17J80-10: EKL02_03805
Help
Entry
EKL02_03805 CDS
T05896
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
jaj
Janthinobacterium sp. 17J80-10
Pathway
jaj00770
Pantothenate and CoA biosynthesis
jaj01100
Metabolic pathways
jaj01240
Biosynthesis of cofactors
Module
jaj_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
jaj00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
EKL02_03805
Enzymes [BR:
jaj01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
EKL02_03805
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
QAU33377
LinkDB
All DBs
Position
857099..857599
Genome browser
AA seq
166 aa
AA seq
DB search
MVTAIYPGTFDPLTRGHEDLVRRASGLFDKLIVGVADSQNKKPFFSLEERLEIANEVLGH
YPNVQVETFSGLLKDFVRQHDGRVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETLFLTPS
DQYQFISGTIVREIASLGGDVSKFVFPSVEKWLKTKLAARVATSGN
NT seq
501 nt
NT seq
+upstream
nt +downstream
nt
atggtcaccgcaatttatccaggtacgttcgacccgctgacgcgtgggcatgaagatttg
gtacggcgcgcctctggcctgttcgataagctgatcgtcggtgtggccgacagtcaaaac
aagaaaccgttcttttctctggaagagcgcctggaaattgccaacgaggtgctggggcat
tatcccaacgtccaggtagaaaccttttccggtctcctcaaggatttcgtgcgccagcat
gatggccgcgtgatcgtgcgcggcttgcgcgctgtctcggacttcgaatacgaattccag
atggccggcatgaaccgttacctgttgcctgatgtcgaaaccctattcctgacgccatcg
gaccagtaccagttcatttcgggtaccattgtgcgtgagatcgccagcctgggcggcgat
gtttccaagtttgtatttccgtcggtcgagaagtggctcaagaccaagctcgctgcgaga
gtcgcgacatccggcaattga
DBGET
integrated database retrieval system