Janthinobacterium sp. 17J80-10: EKL02_09585 Help Entry EKL02_09585       CDS       T05896                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism jaj  Janthinobacterium sp. 17J80-10 Brite KEGG Orthology (KO) [BR:jaj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:jaj03032]     EKL02_09585    03036 Chromosome and associated proteins [BR:jaj03036]     EKL02_09585    03400 DNA repair and recombination proteins [BR:jaj03400]     EKL02_09585 DNA replication proteins [BR:jaj03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EKL02_09585 Chromosome and associated proteins [BR:jaj03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EKL02_09585 DNA repair and recombination proteins [BR:jaj03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EKL02_09585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 TBPIP HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QAU34411 UniProt:  A0A410USS5 LinkDB All DBs Position 2093042..2093314 Genome browser AA seq 90 aa AA seqDB search MNKSELIDHIAESADLSKADAGRALDALVDAVKITLKKNGTVTLVGFGTFSVGKRAARTG RNPQTGAAIKIKAAKVPKFKPGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatccgaattaatcgatcacattgccgaatctgccgatctgtccaaggccgat gcaggtcgtgcgctggatgcgctggtcgatgcagtcaagatcacgttgaaaaagaacggt actgtgaccctggtgggctttggtactttctcggtaggcaagcgcgctgcgcgcaccggc cgcaatccgcaaactggcgcggcgatcaagatcaaggcagccaaggtgccgaagtttaag ccgggcaaaggcctgaaagacgccgtcaactaa

DBGET integrated database retrieval system