Janthinobacterium sp. 17J80-10: EKL02_15035 Help Entry EKL02_15035       CDS       T05896                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jaj  Janthinobacterium sp. 17J80-10 Pathway jaj01100   Metabolic pathways jaj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jaj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EKL02_15035    00074 Mycolic acid biosynthesis     EKL02_15035   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EKL02_15035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QAU36125 LinkDB All DBs Position 3344485..3344736 Genome browser AA seq 83 aa AA seqDB search MQAFEEIKALLIDTLHLGERGKHLTQNTHLLGNLPELDSMAVLHLITALEEHFGIAVEDD DISASTFETVASLTAFVDSKLAQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcaagcattcgaagaaataaaagctctgttgatcgataccctccatcttggagagcgc ggaaaacacctcactcagaacacgcatttgctgggcaatctgccagagctcgattccatg gctgtccttcacctgatcactgcacttgaagaacatttcggcattgctgtcgaggatgac gatatcagtgccagcacctttgaaacggtggcaagcctcacggcatttgtcgacagcaaa ctggcgcaatga

DBGET integrated database retrieval system