Janthinobacterium sp. LM6: BZG29_02570
Help
Entry
BZG29_02570 CDS
T04756
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
jal
Janthinobacterium sp. LM6
Pathway
jal00190
Oxidative phosphorylation
jal01100
Metabolic pathways
jal02020
Two-component system
Module
jal_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
jal00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
BZG29_02570
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
BZG29_02570
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
BZG29_02570
Enzymes [BR:
jal01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
BZG29_02570
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Rieske
UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID:
AQR67361
LinkDB
All DBs
Position
complement(588787..589395)
Genome browser
AA seq
202 aa
AA seq
DB search
MSNEKQVDSGRRGLLVATCAAGSVVGLATAGALVSTFQPSERAKAAGAPVEVDITTLQPG
EMRTVEWRGKPVWILKRTPEMIASLKQTDGKVADANSQRNPAEFTPPYCMNEARSIKPEI
LVAVGICTHLGCSPSSKFTPGPQPSLPDDWEGGFLCPCHGSTFDMAGRVFKNKPAPDNLQ
VPRHMYLSDTKLLIGKDEKGEA
NT seq
609 nt
NT seq
+upstream
nt +downstream
nt
atgagtaacgaaaagcaggtcgattcaggccgtcgcggcttgctcgtcgccacgtgcgcg
gcgggcagtgtagttggattggcaaccgcgggagccttggtaagcaccttccagccgtcg
gagcgcgcgaaagcggctggcgcgccggtcgaagtagacatcaccaccttgcaacccggc
gaaatgcgcaccgtcgaatggcgcggcaagccggtctggatcctgaagcgcacgccggaa
atgatcgcgtcgctcaagcaaaccgatggcaaggtcgccgatgccaattcccaacgtaat
cccgccgaattcacgccgccgtactgcatgaacgaggcgcgctcgatcaagcctgaaatt
ctcgtcgccgtcggcatctgcacccacctgggctgctccccttcctcgaaatttaccccc
ggcccgcaaccgtcgctgcccgatgactgggaaggcggcttcctgtgcccttgccacggc
tccaccttcgacatggctggccgcgtgttcaagaacaagccggcgccggacaacctgcaa
gtgccgcgccatatgtacctgagcgacaccaaattgctgataggtaaagacgagaaaggc
gaggcttga
DBGET
integrated database retrieval system