Janthinobacterium sp. LM6: BZG29_12140 Help Entry BZG29_12140       CDS       T04756                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism jal  Janthinobacterium sp. LM6 Pathway jal00190   Oxidative phosphorylation jal01100   Metabolic pathways jal02020   Two-component system Module jal_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:jal00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BZG29_12140  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BZG29_12140 Enzymes [BR:jal01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BZG29_12140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AQR69004 LinkDB All DBs Position 2710522..2710647 Genome browser AA seq 41 aa AA seqDB search MWYFAWILGLPLAATFAVLNAMWYEVADGDTTPEQYRDTSD NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggatactgggtcttccgctggcggcgaccttcgccgtgctcaat gcgatgtggtatgaagtcgccgatggcgacacgacgcccgagcagtaccgcgacacgtcc gattaa

DBGET integrated database retrieval system