Janthinobacterium sp. LM6: BZG29_14735 Help Entry BZG29_14735       CDS       T04756                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jal  Janthinobacterium sp. LM6 Pathway jal01100   Metabolic pathways jal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BZG29_14735    00074 Mycolic acid biosynthesis     BZG29_14735   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BZG29_14735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AQR69454 LinkDB All DBs Position complement(3356234..3356479) Genome browser AA seq 81 aa AA seqDB search MPHLEAVKHILDTTLGLNGRALEAHTPLLGSVPELDSMAVIGVIAALEDHFGIVVADDDI HARHFATVGTLHDFVFAKLRA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgccgcatcttgaagcagtaaagcacatcctcgacacgacgctgggcttgaacgggcgc gcgctggaagcccacacgccgctgctgggcagcgtgccggaactcgactcgatggccgtg atcggcgtgatcgccgcgctggaagaccatttcggcatcgtggtcgccgacgacgacatc catgcgcgccacttcgccaccgtcggcaccctgcacgatttcgtgtttgcaaagctgcga gcatga

DBGET integrated database retrieval system