Jannaschia sp. CCS1: Jann_4205 Help Entry Jann_4205         CDS       T00330                                  Symbol flgJ Name (GenBank) flagellar protein FlgJ putative   KO K02395   peptidoglycan hydrolase FlgJ Organism jan  Jannaschia sp. CCS1 Pathway jan02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:jan00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Jann_4205 (flgJ)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:jan02035]     Jann_4205 (flgJ) Bacterial motility proteins [BR:jan02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     Jann_4205 (flgJ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  ABD57122 UniProt:  Q28JJ0 LinkDB All DBs Position complement(4309966..4310268) Genome browser AA seq 100 aa AA seqDB search MTTPILSSTPGSAGSMPTDDPHARIREVAQDLEAAFLAEMLKHAGFGEPRDDDSFGGGIG EEQFSSMLRDQHASAISERGGLGLAESIFQSLLRRSEGVQ NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgacgacaccgattctatcctcaacgcccggatctgccggatcgatgcctactgatgac ccgcacgcgcgaatacgcgaggtagcgcaagatctggaggccgccttcctggcggagatg ttgaaacatgcgggtttcggagaaccgcgtgacgatgacagtttcggcgggggaattgga gaggaacagttttcctccatgttgcgcgaccagcatgccagcgcgatttcagagcgaggc ggtcttggcttggccgaatctatctttcaatcacttttgcgacggtcggagggcgtgcaa tga

DBGET integrated database retrieval system