Jeotgalibaca arthritidis: G7057_10460 Help Entry G7057_10460       CDS       T06477                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism jar  Jeotgalibaca arthritidis Brite KEGG Orthology (KO) [BR:jar00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:jar03032]     G7057_10460    03036 Chromosome and associated proteins [BR:jar03036]     G7057_10460    03400 DNA repair and recombination proteins [BR:jar03400]     G7057_10460 DNA replication proteins [BR:jar03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     G7057_10460 Chromosome and associated proteins [BR:jar03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     G7057_10460 DNA repair and recombination proteins [BR:jar03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       G7057_10460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_euk_1 HU-CCDC81_bac_2 DUF2267 Synaptobrevin Permuted_GreAB-C HU-DNA_bdg FIVAR DUF4777 ROS_MUCR Motif Other DBs NCBI-ProteinID:  QII82820 UniProt:  A0A6G7KC53 LinkDB All DBs Position 2079545..2079823 Genome browser AA seq 92 aa AA seqDB search MTNKAELVERVADKTNLTKKEVTATVDALFEAIQEALQNGEKVQVIGFGNFEVRDRAARK GRNPQTGEEIQIEATKVPAFKPGKALKDAVKG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacaaacaaagctgaattagtagaacgcgttgctgataaaacaaaccttacaaaaaag gaagttacagctactgtagatgcattatttgaagcaattcaagaagctttacaaaacggt gaaaaagttcaagttatcggatttggtaactttgaagtacgtgaccgtgctgctcgtaaa ggacgtaaccctcaaacaggggaagaaatccaaatcgaagcaactaaagtacctgctttc aaaccaggtaaagcattgaaagatgcagttaaagggtaa

DBGET integrated database retrieval system