Jeotgalibaca arthritidis: G7057_11395 Help Entry G7057_11395       CDS       T06477                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jar  Jeotgalibaca arthritidis Pathway jar01100   Metabolic pathways jar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G7057_11395    00074 Mycolic acid biosynthesis     G7057_11395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G7057_11395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 PP-binding_2 Motif Other DBs NCBI-ProteinID:  QII82992 UniProt:  A0A6G7KCN8 LinkDB All DBs Position complement(2281376..2281600) Genome browser AA seq 74 aa AA seqDB search MTFEKIQAIIVDQLDKDEAEVTLTTNFREDLDADSLDLFQIINDIEDEFDIKIESDEGIN TVEDLVKYVDAQLA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacattcgaaaaaattcaagcaattattgtagaccaattggacaaagatgaagcagaa gtaacattaacaactaacttccgtgaagatttagacgcagacagcttagacttattccaa atcatcaacgatatcgaagatgaatttgatattaaaatcgaaagcgacgaaggaatcaac actgtagaagacttagtaaaatatgttgatgcacaattagcataa

DBGET integrated database retrieval system