Janthinobacterium tructae: FJQ89_04250 Help Entry FJQ89_04250       CDS       T06359                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jas  Janthinobacterium tructae Pathway jas01100   Metabolic pathways jas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FJQ89_04250    00074 Mycolic acid biosynthesis     FJQ89_04250   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FJQ89_04250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QDG69711 UniProt:  A0A4Y6R9R9 LinkDB All DBs Position complement(977215..977460) Genome browser AA seq 81 aa AA seqDB search MPHLEAVKRILDTTLGLNGRALEEHTPLLGSVPELDSMAVIGVIAALEDHFGIIVADDDI HARHFATVGTLHDFVFAQLRP NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgccgcatcttgaagcagtaaaacgcatcctcgacaccaccctgggcttgaacgggcgc gcgctggaagagcacacgccgctcttgggcagcgtgccggaactcgactcgatggccgtg atcggcgtgatcgccgcgctggaagaccatttcggcatcattgtcgccgacgacgacatc cacgcgcgccacttcgccaccgtgggcaccctgcacgacttcgtgtttgcacagctgcgg ccatga

DBGET integrated database retrieval system