KEGG   Janthinobacterium tructae: FJQ89_05140
Entry
FJQ89_05140       CDS       T06359                                 
Name
(GenBank) ATP-binding cassette domain-containing protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
jas  Janthinobacterium tructae
Pathway
jas02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:jas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FJQ89_05140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:jas02000]
    FJQ89_05140
Enzymes [BR:jas01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     FJQ89_05140
Transporters [BR:jas02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    FJQ89_05140
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 RsgA_GTPase AAA_29 nSTAND1 AAA_25 AAA_22 NACHT AAA_28 Mg_chelatase AAA_33 TsaE DO-GTPase2 AAA_30 IstB_IS21 AAA_5 AAA nSTAND3 AAA_24 AAA_23
Other DBs
NCBI-ProteinID: QDG69870
UniProt: A0A4Y6RBU2
LinkDB
Position
1172339..1173151
AA seq 270 aa
MTFQLHKICVHHAGAAGNALALRELDLDVAQGEQIALIGPSGAGKTSLLHTLACALRPES
GTLSVLGSSPWLIGSAERHALRARLFLAPQTPPLPPRQRVVNAVLAGRLPQWSLWTAMRS
LLAPVDPRTAWEALGKFNLQDKLYARVDRLSGGERQRCGMARALVSNAQAFLVDEPLSAL
DPTLALQTIHVLQAEARARNATLICSLHQVDIARACFTRIVALRDGKIVFDLPSSEVSDA
MIERLYRNKADPAPQFEAVDAKLDAARPLC
NT seq 813 nt   +upstreamnt  +downstreamnt
atgacattccaacttcacaagatctgcgtccaccacgcgggcgccgccggcaatgcgctg
gccctgcgcgagctggacctggacgtggcgcaaggtgaacagatcgccctgatcggcccc
tccggcgccggcaagaccagtctgctgcacacgctggcctgcgcgctgcgccccgagtcc
ggcaccttgagcgtcctcggcagttctccgtggctgatcggcagcgccgagcgccacgcc
ttgcgtgcgcgcctgtttttggcgccgcaaacgccgccgctgccgccgcgccagcgcgtc
gtcaacgccgtcctggcgggccggctgccgcaatggagcttgtggacggcgatgcgttcc
ctgctggcccccgtcgacccgcgcaccgcgtgggaggctttaggcaaattcaatctgcag
gacaaactgtatgcgcgcgtcgaccgcctgtccggcggcgaacgccagcgctgcggcatg
gcgcgcgcgctggtgtcgaatgcgcaagcgttcctcgtcgacgaaccgctgtccgcgctc
gaccccacgctggccctgcaaacgatccatgtgctgcaagcggaagcaagagcgcgcaac
gccaccctgatctgcagcctgcaccaggtcgatatcgcgcgcgcctgttttacgcgcatc
gtcgccctgcgcgacggcaagatcgtcttcgacttgcccagcagcgaggtcagcgacgcc
atgatagagcggctgtaccgcaacaaggccgatccggcgccgcagttcgaggcagtggac
gcgaaactggacgccgcgaggccgctttgctga

DBGET integrated database retrieval system