Janthinobacterium tructae: FJQ89_09780 Help Entry FJQ89_09780       CDS       T06359                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jas  Janthinobacterium tructae Pathway jas01100   Metabolic pathways jas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FJQ89_09780 (acpP)    00074 Mycolic acid biosynthesis     FJQ89_09780 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FJQ89_09780 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  QDG70664 UniProt:  A0A4Y6RDT1 LinkDB All DBs Position complement(2241443..2241682) Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKIESSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcggatatcgaacaacgcgttaagaaaatcgtcgctgagcaactgggcgttgcagaa gcagacatcaaaatcgaatcctccttcgtcgacgatctcggcgccgattccctggacacc gtggaactggtcatggccctggaagacgaattcgaaatggaaatccctgacgaacaagct gaaaaaatcaccaccgtgcaacaggcgatcgactacgccaccgcacacgtcaaggcctaa

DBGET integrated database retrieval system