Janthinobacterium tructae: FJQ89_11755
Help
Entry
FJQ89_11755 CDS
T06359
Name
(GenBank) entericidin A/B family lipoprotein
KO
K16347
entericidin A
Organism
jas
Janthinobacterium tructae
Brite
KEGG Orthology (KO) [BR:
jas00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
jas02000
]
FJQ89_11755
Transporters [BR:
jas02000
]
Other transporters
Others
FJQ89_11755
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Entericidin
LPAM_1
CHAT
Motif
Other DBs
NCBI-ProteinID:
QDG71012
UniProt:
A0A4Y6RDC2
LinkDB
All DBs
Position
complement(2688461..2688583)
Genome browser
AA seq
40 aa
AA seq
DB search
MKKLFALLIVTVVLSGCNTVSGIGRDVQKVGQVVTGAGGK
NT seq
123 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaaactcttcgccctcctcatcgtcaccgtcgtcctgtccggctgcaacaccgtc
tccggcatcggccgcgatgtgcagaaagtcggccaggtcgtcactggcgccggcggaaaa
taa
DBGET
integrated database retrieval system