Janthinobacterium tructae: FJQ89_25370
Help
Entry
FJQ89_25370 CDS
T06359
Symbol
lptG
Name
(GenBank) LPS export ABC transporter permease LptG
KO
K11720
lipopolysaccharide export system permease protein
Organism
jas
Janthinobacterium tructae
Pathway
jas02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
jas00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
FJQ89_25370 (lptG)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
jas02000
]
FJQ89_25370 (lptG)
Transporters [BR:
jas02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
FJQ89_25370 (lptG)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
Motif
Other DBs
NCBI-ProteinID:
QDG73393
UniProt:
A0A4Y6RKA9
LinkDB
All DBs
Position
5766710..5767879
Genome browser
AA seq
389 aa
AA seq
DB search
MKILQRYFAVSIFQAVLFVLLAFLALQAFIDLTGELPKVGRNGYTIQYAFLYVLVLVPGH
VYEVMPIAALIGTIYTMAQFAASSEFTIMRASSMSTAMAAGFLFRIGIVFVVITFIFGEL
ITPRTEPLAERLKLTSRGAAVSSEFRSGLWTKDMVKSDGLTGTVTGSRFFNVGEARPDGQ
LKNVKLYEFDTDMRLRTLTVAKGATYQGNNIWRLTDVTETSFSNSAATSPGFEPKLANYF
GQETSLVRTVQSASKDMTSEVTPKILTVSASDPERMSASELAVYTRHLAENKQETERFRI
AFWKKLIDPLAIFVLMALALPFAYMHTRSGGISLKIFIGIMIGVSFMLVNTLFSHLGLLS
TWPAFLTAVAPSTLYLLLALGALWWVERH
NT seq
1170 nt
NT seq
+upstream
nt +downstream
nt
atgaagattttacagcgctattttgcggtctcgatattccaggcggtgctgttcgtgctg
ctggccttcctggcactgcaagccttcatcgacctgacgggcgagctgccgaaggtgggc
cgcaacggctacaccatccagtatgccttcctgtatgtgctggtgctggtgccggggcat
gtgtacgaggtgatgccgattgcggcactgatcggcacgatctacacgatggcgcagttc
gcggccagttccgaatttaccatcatgcgcgcctcgagcatgtcgacggcgatggcggcc
ggtttcctgttccgcatcggtatcgtcttcgtggtcatcaccttcatctttggtgagctg
atcacgccgcgtaccgagccgctggccgaacgcctcaagctgacgtcgcgcggcgcggcc
gtgtcgagcgagtttcgctcgggcctgtggaccaaggacatggtcaagagcgacggcctg
acgggcaccgtcaccggttcgcgcttttttaatgtgggcgaagcgcgtccggacggccag
ctgaaaaacgtcaagctgtatgaatttgataccgatatgcgtttgcgcaccctgaccgtg
gccaagggggcgacgtatcagggcaataatatctggcgcctgaccgatgtgacggaaacc
tcgttctcgaacagcgcggcgacctcgcccggcttcgaaccgaagctggcgaactacttt
gggcaggaaacgagcctggtgcgcacggtacagagcgccagcaaggacatgacgtcggaa
gtgacgccgaagatcctgacggtgtcggcttccgatcccgagcgcatgtcggccagcgaa
ctggccgtgtacacgcgccacctggccgagaacaagcaggaaaccgagcgtttccgcatc
gctttctggaaaaagctgatcgatccactggccatcttcgtgttgatggcgctggcgctg
ccgttcgcctacatgcacacgcgcagcggcggcatcagcctgaagatcttcatcggcatc
atgatcggcgtgagcttcatgctggtcaacacgctgttttcgcatcttgggctgctcagt
acctggccggccttcctgacggcggtggcgccgagcaccctgtatctgctgctggcgctg
ggcgccttgtggtgggtggaaagacactaa
DBGET
integrated database retrieval system