Jatrophihabitans sp. GAS493: SAMN05892883_1061
Help
Entry
SAMN05892883_1061 CDS
T11165
Name
(GenBank) hypothetical protein
Organism
jat Jatrophihabitans sp. GAS493
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DUF6801
Motif
Other DBs
NCBI-ProteinID:
SOD71554
LinkDB
All DBs
Position
I:1162363..1163943
Genome browser
AA seq
526 aa
AA seq
DB search
MHQPLMRRKSVRAVAGATAFGLAAGFTAILSGGGGAASAATLTKTINTTCTIPVAGAEEY
SANISATIPDSAVVGDSVTLQNFKISILLNVATTDALQILGATTLQGTITAGATLTNATP
SDLGITATVPTTAVPQTQDANGDGPPFSITATGPSPTAVLTSPGTATLTATTVAAFFDPK
NAAGTSVLPAAKRNIPCTFDAGQSLVLGSIPVTAPTPVPTPVPTAVPTPVPTPVPTAVPT
PVPTPVPTAVPTPVPTAVPTPVPTAVPTPVPTAVPTPVPTAVPTPVPTAVPTPVPTAVPT
PVPTAVPTPVPTAVPTPVPTAVPTPVPTAVPTPVPTAVPTPVPTAVPTPVPTAVPTPVPT
AVPTPAPAGHHDFTFTGSASAAGLTIGFGPGKASVDVSGTGAVTGTASIPTKTVTVYLYG
WVPVTIKVAITPGPVSGTFTGGKWAFSVPVSVSIPSASLFGVIPLIPAGTAVSTVSPSTL
ALTQGSGLNFTGSLKLSKFKNAGAAAPIFDLISGTPIKVSVALSPK
NT seq
1581 nt
NT seq
+upstream
nt +downstream
nt
atgcatcaaccgcttatgcggcgaaaaagcgtccgagcagtggctggggccaccgccttc
gggctagcggccggattcacggccatcctgtctggcggagggggcgccgcgtcagcggcc
acgctgaccaagacgatcaacaccacctgcacgattccggtcgccggggctgaggagtac
tcagccaacatcagcgcgacgatcccggacagtgcggtcgtaggtgactcggtcacgctg
cagaacttcaaaatcagcatcctgctgaacgtcgcgacgacggacgcgctgcagatcctg
ggggccaccacgctgcagggcaccattacggccggcgcaaccctcaccaacgcgacgccg
agtgaccttggcatcaccgccaccgtgccgacgaccgccgttccgcagacgcaggacgcc
aacggagacggcccgccgttcagcatcaccgccaccggtccttcgccgacggcggttctc
acgtcgcccggtacggcgactctcaccgccaccaccgttgccgcgttcttcgacccgaag
aacgcagctggcacgagcgtcctgccggcggccaagcgcaacattccctgcaccttcgac
gctgggcagagcctagtgctcggctccatcccggtgacggctccgactccggttccgact
ccggtcccgacggctgttccgactccggttccgactccggttccgacggctgttccgact
ccggttccgactccggttccgacggctgtcccgacgccggtcccgacggctgttccgacg
ccggtcccgaccgctgttccgaccccggttccgaccgctgttccgacgccggtcccgacc
gctgtcccgacgccggtcccgaccgctgtcccgacgccggtcccgaccgctgtcccgacg
ccggtcccgacggctgttccgacgccggtcccgaccgctgttccgacgccggtcccgacc
gctgttccgacgccggtcccgaccgctgtcccgacgccggtcccgaccgctgtcccgacg
ccggtcccgaccgctgtcccgacgccggtcccgacggctgttccgacgccggtcccgacg
gctgttccgacgcctgcaccggctggtcaccatgacttcaccttcactggctcggccagt
gcggctggtctgaccatcgggttcggtccgggcaaggccagcgttgacgtctccggcacc
ggagccgtcaccggtaccgcttcgattccaacgaagacggtgacggtctacctctacggc
tgggtcccggtcacgatcaaggtcgcgatcacgcctggcccggtcagtggaaccttcact
ggcggaaagtgggccttctcggtaccggtgagcgtgtcgatcccatcggcgagtctcttc
ggagtcatcccgctcatcccggccggtacggccgtctccactgtctcgccgtcgacactg
gcgctgactcaggggtccggtctgaacttcactggcagcctcaagctgtcgaagttcaag
aacgccggggcggcagcgccgatcttcgacctgatcagcggaactccgatcaaggtctcc
gtcgcactgagcccgaaatag
DBGET
integrated database retrieval system