Jatrophihabitans sp. GAS493: SAMN05892883_2722
Help
Entry
SAMN05892883_2722 CDS
T11165
Name
(GenBank) phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
jat Jatrophihabitans sp. GAS493
Pathway
jat00770
Pantothenate and CoA biosynthesis
jat01100
Metabolic pathways
jat01240
Biosynthesis of cofactors
Module
jat_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
jat00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
SAMN05892883_2722
Enzymes [BR:
jat01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
SAMN05892883_2722
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Pantoate_ligase
PLN_propep
Motif
Other DBs
NCBI-ProteinID:
SOD73430
LinkDB
All DBs
Position
I:2884916..2885431
Genome browser
AA seq
171 aa
AA seq
DB search
MTESALVRRAICPGSFDPVTNGHLDIIGRSAALYDELVVAVFVNQSKSSMFSVDERIDML
TEATVAYPNVRIEAFQGLVVDYCRAHDIPVIVKGLRAVSDFDYELQMAQMNRNMAGVDTL
FMPTNPEYSFLASSLVKEIANWSGDVSALVPPHVLQRLAERAKHHQRATDE
NT seq
516 nt
NT seq
+upstream
nt +downstream
nt
atgactgaatcagccttggttcgacgcgcaatctgtccggggtccttcgaccccgtgacc
aacggtcacctggacatcatcggccgatcagccgctctctacgatgagctggtcgtcgcc
gtcttcgtcaaccagtcgaagtcgtcgatgttctcggtggacgaacgcatcgacatgctc
accgaggcaactgtcgcctacccgaacgtccggatcgaagcctttcaaggcctggtcgtc
gactactgccgagcgcacgacatcccggtgatcgtcaagggtctgcgggcggtcagcgac
ttcgactacgagctgcagatggcccagatgaatcggaacatggccggcgtcgacacactc
ttcatgccgaccaatcccgagtacagcttcctggcctccagcctggtcaaggagatcgcg
aactggagcggcgacgtcagcgcgctggtcccgccccatgtgctgcagcgcttggccgaa
cgagcgaagcaccaccagcgagcgaccgatgagtga
DBGET
integrated database retrieval system