Jatrophihabitans sp. GAS493: SAMN05892883_4226 Help Entry SAMN05892883_4226 CDS       T11165                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jat  Jatrophihabitans sp. GAS493 Pathway jat01100   Metabolic pathways jat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jat00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SAMN05892883_4226    00074 Mycolic acid biosynthesis     SAMN05892883_4226   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SAMN05892883_4226 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF6511 Motif Other DBs NCBI-ProteinID:  SOD75026 LinkDB All DBs Position I:4659325..4659591 Genome browser AA seq 88 aa AA seqDB search MRTPTLTDIRDSVRASLAEVVRIAPESVQMDRRLNEFPDVDSLALIELITDCEQQWGILL DEDELFDIRTGDDLAQLILRSLASLPTA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagaactcccacattgaccgatatcagggactccgtgcgagctagcctggccgaggtt gtgaggatagcgccggagagcgtccagatggatcgtcgcctcaacgagttcccagacgtc gactcgttggcattgatcgagttgatcaccgactgcgagcaacaatgggggattctcctc gacgaggacgagctgtttgatatccgaaccggtgacgatcttgctcaactcatcctgcgc tccctcgcttcgttacccacggcatga

DBGET integrated database retrieval system