Antarcticirhabdus aurantiaca: OXU80_12200 Help Entry OXU80_12200       CDS       T09604                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism jav  Antarcticirhabdus aurantiaca Pathway jav02024   Quorum sensing jav03018   RNA degradation Brite KEGG Orthology (KO) [BR:jav00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     OXU80_12200 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     OXU80_12200 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:jav03019]     OXU80_12200 (hfq)    03036 Chromosome and associated proteins [BR:jav03036]     OXU80_12200 (hfq) Messenger RNA biogenesis [BR:jav03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      OXU80_12200 (hfq) Chromosome and associated proteins [BR:jav03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     OXU80_12200 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  WAJ30913 LinkDB All DBs Position 2518030..2518278 Genome browser AA seq 82 aa AA seqDB search MAERSQNLQDLFLNTVRKQKISLTIFLVNGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVNMQDSGEEDRKS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgaacggtcgcaaaatcttcaggatctcttcctcaatacggtacgcaagcagaag atctcgctgacgatctttctcgtcaacggtgtgaagctgaccggcgtcgtaacgtcgttt gacaatttttgtgtcctgcttcgacgcgatgggcactcgcaactcgtctacaagcacgcc atatctacgatcatgccgtcgcagcccgtgaacatgcaggactcgggcgaggaagacagg aagagctga

DBGET integrated database retrieval system