Antarcticirhabdus aurantiaca: OXU80_24600
Help
Entry
OXU80_24600 CDS
T09604
Name
(GenBank) hypothetical protein
Organism
jav
Antarcticirhabdus aurantiaca
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
WAJ27976
LinkDB
All DBs
Position
complement(5083912..5084304)
Genome browser
AA seq
130 aa
AA seq
DB search
MIDFDIVRRTGLAAAVGLAMAASAPAIAFAQDSGGSSSSSSGDSGGTSGDTGGTSGDDGT
TGGDNGTTAGDDSSSGASGAASAASGSTASGGTGSDTCGGTDNVPGGEDVQCDNPTNNGA
TSSSGASSSQ
NT seq
393 nt
NT seq
+upstream
nt +downstream
nt
atgatcgattttgacatcgtccgcaggacaggcttggccgcggcggtcggcctcgcgatg
gccgcgagcgccccggcgatcgccttcgcgcaggactccggcggatcgtcgtcgagctcg
agcggcgacagcggcggcacgtccggcgacaccggcggcacctcgggcgacgacggcacg
acgggtggcgacaacggcaccacggcaggagacgacagctcatcgggcgcctcgggagcg
gcgtcggccgcttcgggatcgacggcgtcgggcggcaccggcagcgacacctgcggcggg
acggacaacgtgccgggcggcgaggacgtccagtgcgacaaccccaccaacaatggcgcg
acctcgtcgagcggcgcgtcctcgtcccagtaa
DBGET
integrated database retrieval system