Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_05890 Help Entry YQ44_05890        CDS       T04539                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jaz  Janthinobacterium sp. 1_2014MBL_MicDiv Pathway jaz01100   Metabolic pathways jaz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jaz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     YQ44_05890    00074 Mycolic acid biosynthesis     YQ44_05890   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     YQ44_05890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  APA67453 UniProt:  A0A1I9XUL1 LinkDB All DBs Position 1348763..1349017 Genome browser AA seq 84 aa AA seqDB search MLEQEVKELIIEALQLEDMSAADIDTDAPLFVEGLGLDSIDALELGVALQKKYGISLSAD SADTRRHFASVRALAAMVDTHRKK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcttgaacaagaagtgaaggaactgatcatcgaggcgctgcaactggaagacatgagc gctgccgatatcgatacggatgcgcccctgtttgtcgagggcctgggactcgattcgatc gatgcgctggaactgggcgtcgccctgcaaaaaaaatacggcatttccctgtcggccgat tcggccgatacgcgccgccactttgcctcggtacgggcgctggcggccatggttgacact cacagaaagaagtaa

DBGET integrated database retrieval system