Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_05895 Help Entry YQ44_05895        CDS       T04539                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jaz  Janthinobacterium sp. 1_2014MBL_MicDiv Pathway jaz01100   Metabolic pathways jaz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jaz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     YQ44_05895    00074 Mycolic acid biosynthesis     YQ44_05895   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     YQ44_05895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD HalOD1 Motif Other DBs NCBI-ProteinID:  APA67454 LinkDB All DBs Position 1349047..1349304 Genome browser AA seq 85 aa AA seqDB search MSRDELYAWVVQLLAEMFELDPAALTPQSNLYAELDIDSIDAVDLAVKLKQLTGKRLQPE VFKTIRTIDDVVEALRAMSATEQAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagccgcgatgaactgtacgcgtgggtagtccaactgctggctgaaatgttcgagctg gatccggcggcgctgacgccgcagtcgaatctgtatgcggaactcgatatcgacagcatc gacgcggtcgacctggcggtcaagttgaagcagttgacgggcaagcgcctgcagccggaa gtgttcaagaccatccgcacgatcgacgacgtggtcgaggcgctgcgcgcgatgtcggcg acggaacaggcggcataa

DBGET integrated database retrieval system