Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_08010
Help
Entry
YQ44_08010 CDS
T04539
Name
(GenBank) sulfate transporter
KO
K03321
sulfate permease, SulP family
Organism
jaz
Janthinobacterium sp. 1_2014MBL_MicDiv
Brite
KEGG Orthology (KO) [BR:
jaz00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
jaz02000
]
YQ44_08010
Transporters [BR:
jaz02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
YQ44_08010
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
STAS
STAS_2
MFS_MOT1
HHV6-IE
Motif
Other DBs
NCBI-ProteinID:
APA67796
LinkDB
All DBs
Position
1788312..1789799
Genome browser
AA seq
495 aa
AA seq
DB search
MINATFRDEWFSNIQKNMLAGLTTSFALVPECIAFALVAQLNPLMGLYGAFIICALTAIF
GGRPGMISGAAGSMAVVIVALVAQHGVQYLLATVVLGGILMALFGILRLGKLIRMVPHPV
MLGFVNGLAIIIAMAQLEHFRQATPQGEQWLHGASLFVMGALVALTMAIVYVLPRLTKAV
PPALVAILGVGVLSYSLHLPTRTLGDLAHIAGGLPALHFPTVPLDMATLHVIFPYAALMA
LVGLLETLLTFNLTDDITQTKGQPNRECIALGASNVVSGLFGGMGGCAMIGQTMINLSSG
GRSRLSGVTAGVMILLFILFLSPLIERIPLAALVGVMFVVAQQTFAWGSLRVLGKVPRHD
ALVIVAVTIITVLTDLATAVLCGIVIAALSFAWQHAREMRADIDDSTPGVRVYAPHGTLF
FASTTHFQELFQSATDPLRIILDCRHLHMADHSAIAAIEALYERYGKAGKHVQVTHLSGR
NQALLQRAGVDVSVA
NT seq
1488 nt
NT seq
+upstream
nt +downstream
nt
atgatcaacgcaacttttcgggatgagtggttctcgaacatacaaaaaaatatgctggcg
ggtctgaccacctcgtttgccctggtgcccgaatgcatcgcctttgccctggtggcgcag
ctcaatcccttgatgggcctgtacggcgccttcatcatctgcgcgctgacggccatcttt
ggcggacgccctggcatgatttcgggcgccgccggttccatggccgtcgtcatcgtggcg
ctggtggcgcagcacggcgtgcaatatttgctggcgacggtggtgctcggcggcatcctg
atggcgctgttcggtatcttgcgcctgggtaaactgatccgcatggtgccgcacccggtg
atgctgggctttgtgaacggcctggccatcatcatcgccatggcccagctggaacacttt
cgccaggccacgccgcaaggcgagcaatggctgcacggcgcgtccttgttcgtgatgggc
gcgctggtggcgctgaccatggccatcgtgtacgtgctgccgcgcctgacaaaagccgtg
ccgccggcgctggtggccatcctcggcgttggcgtgctcagctatagtttgcatctgccg
acgcgcaccctgggcgacctcgcgcatatcgccggcggcttgccggccctgcatttcccc
accgtgccgctggacatggctaccttgcacgtgatcttcccgtacgcggccctgatggcc
ctggtgggcttgctggaaaccttgctcacctttaacctgaccgacgacatcacgcaaacg
aagggccagccgaaccgcgaatgcatcgcgctgggcgcgtcgaacgtcgtctcgggcctg
tttggcggcatgggcggctgcgccatgatcgggcagacgatgatcaacctgagttccggc
ggccgttcgcgcctgtcgggcgtcacggccggcgtgatgattttattgttcatcctgttc
ctgtcgccgctgatcgaacgcattccgctggccgccctagtgggcgtgatgttcgtcgtg
gcgcagcagacgtttgcctggggttcgctgcgcgtgctgggcaaggtgccgcggcacgat
gcgctggtgatcgtcgccgtcaccatcatcacggtgttgacggacctggcgacggccgtg
ctgtgcggcatcgtcattgccgccttgagttttgcctggcaacatgcacgcgagatgcgc
gccgacatcgatgacagcacgccgggtgtgcgcgtgtacgcaccgcatggcaccctgttt
ttcgcttcgacgacgcatttccaggagctgttccagagtgcgacggacccgctgcgcatc
atcctcgactgccgccacctgcacatggccgatcattcggccatcgccgccatcgaggcc
ctgtacgagcgctacgggaaggcgggcaagcatgtgcaggtcacgcacttgtccggacgc
aaccaggccttgctgcagcgcgcgggcgtcgacgtgagcgtggcgtaa
DBGET
integrated database retrieval system