Jatropha curcas (Barbados nut): 105638811 Help Entry 105638811         CDS       T03922                                  Name (RefSeq) SKP1-like protein 14   KO K03094   S-phase kinase-associated protein 1 Organism jcu  Jatropha curcas (Barbados nut) Pathway jcu03083   Polycomb repressive complex jcu04120   Ubiquitin mediated proteolysis jcu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:jcu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105638811    04120 Ubiquitin mediated proteolysis     105638811   09126 Chromosome    03083 Polycomb repressive complex     105638811  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jcu04131]     105638811    04121 Ubiquitin system [BR:jcu04121]     105638811    03036 Chromosome and associated proteins [BR:jcu03036]     105638811 Membrane trafficking [BR:jcu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     105638811 Ubiquitin system [BR:jcu04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      105638811    Cul7 complex      105638811 Chromosome and associated proteins [BR:jcu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      105638811   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      105638811 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ AvrM-A Motif Other DBs NCBI-GeneID:  105638811 NCBI-ProteinID:  XP_012078064 UniProt:  A0A067KMG6 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MESKQTITLKTFDNKLFEIEEAVAMEMITVKSFFDEFADNSSSSSKATIIPLPNVSSASL SLIITYIEDYLKLKSNPTDLKAYNAEFVKKQAVDIKELILAVNYLNIKYLLDLLSQAIAD HINNKSVEYVRGYFGFENDFTPQEEARLREENAWAYEGVDQD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggaatcaaagcaaaccattaccttgaagaccttcgacaataagcttttcgagatagaa gaagccgtggctatggagatgattactgtgaaaagttttttcgatgagtttgctgataat tcttcttcctcgtctaaagctaccataattcctctccctaacgtgtcatccgcgtcgctt tctttgataataacttacatcgaggattacttgaagttgaaatctaatccaaccgatctc aaagcttataatgcagaatttgtgaagaaacaagctgtagacataaaagaattgattttg gcggttaattatctaaacatcaagtatttgttggatttgcttagtcaggccattgctgat catattaataacaagagcgtcgaatatgttcgtggctattttgggtttgagaatgatttt acgccacaagaggaagctagacttcgcgaggagaacgcttgggcttacgagggtgttgat caagattaa

DBGET integrated database retrieval system