Jatropha curcas (Barbados nut): 105639767 Help Entry 105639767         CDS       T03922                                  Name (RefSeq) ADP-ribosylation factor 1   KO K07937   ADP-ribosylation factor 1/2 Organism jcu  Jatropha curcas (Barbados nut) Pathway jcu04144   Endocytosis Brite KEGG Orthology (KO) [BR:jcu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105639767  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jcu04131]     105639767   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:jcu04147]     105639767    04031 GTP-binding proteins [BR:jcu04031]     105639767 Membrane trafficking [BR:jcu04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     105639767   Arf GTPases and associated proteins    Arf GTPases     105639767  Endosome - Golgi transport     105639767 Exosome [BR:jcu04147]  Exosomal proteins   Proteins found in most exosomes    105639767 GTP-binding proteins [BR:jcu04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     105639767 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Motif Other DBs NCBI-GeneID:  105639767 NCBI-ProteinID:  XP_037495541 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search NDRERITEARDELHRMLSEDELRDSTLLVFANKQDLPNAMTVSEITDKLGLHSLRQRRWY IQATCATSGQGLYEGLDWLSSNISSKA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt aatgacagggaaaggattacagaagccagagatgagcttcatcgtatgctgagtgaggat gaactacgggattcaacccttcttgtatttgcaaacaagcaagatcttccaaatgcgatg actgtttcagaaattactgataaacttggtctgcactctctgcgccaacgccgttggtac attcaggctacttgtgctacttctggccaaggactctatgagggtcttgattggctgtcc agcaatatctctagcaaggcataa

DBGET integrated database retrieval system