Jatropha curcas (Barbados nut): 105641783 Help Entry 105641783         CDS       T03922                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism jcu  Jatropha curcas (Barbados nut) Pathway jcu04145   Phagosome jcu04148   Efferocytosis jcu04620   Toll-like receptor signaling pathway jcu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:jcu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105641783    04148 Efferocytosis     105641783  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105641783  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105641783  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jcu04131]     105641783   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:jcu04147]     105641783    04031 GTP-binding proteins [BR:jcu04031]     105641783 Membrane trafficking [BR:jcu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105641783  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105641783   Macropinocytosis    Ras GTPases     105641783  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105641783 Exosome [BR:jcu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105641783   Exosomal proteins of other body fluids (saliva and urine)    105641783   Exosomal proteins of colorectal cancer cells    105641783   Exosomal proteins of bladder cancer cells    105641783 GTP-binding proteins [BR:jcu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105641783 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  105641783 NCBI-ProteinID:  XP_012081772 UniProt:  A0A067KBN0 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKAQKTCSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttctaggttcattaaatgcgtcacagttggtgatggtgctgttggcaagact tgcatgctcatctcctacaccagcaacacttttcctactgactatgtgcctactgtgttt gacaacttcagtgcgaatgtggttgtggatgggagcacagtcaatctagggttgtgggat actgctggccaggaagattataatagattaagacctttgagctatcgtggggctgatgtt ttcttgcttgctttctctctcattagcaaggccagttatgaaaatgttgcaaagaagtgg attcctgaattgaggcattatgcacctggagtaccaattatccttgttgggactaagctt gatctccgagatgataagcaattcttcatagatcaccctggtgcagtgcccatcaccaca gctcagggggaggaactgagaaagctaattggagctcctgtttacattgagtgtagttct aaaactcagcagaatgtgaaagcagtctttgatgcagccattaaagtggttctccagcca ccaaaacagaagaagaaaaagaaaaggaaggcacaaaagacatgctccatattgtga

DBGET integrated database retrieval system