Jatropha curcas (Barbados nut): 105641783 Help Entry 105641783         CDS       T03922                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism jcu  Jatropha curcas (Barbados nut) Pathway jcu04145   Phagosome jcu04148   Efferocytosis jcu04517   IgSF CAM signaling jcu04518   Integrin signaling jcu04620   Toll-like receptor signaling pathway jcu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:jcu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105641783    04518 Integrin signaling     105641783  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105641783    04148 Efferocytosis     105641783  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105641783  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105641783  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jcu04131]     105641783   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:jcu04147]     105641783    04031 GTP-binding proteins [BR:jcu04031]     105641783 Membrane trafficking [BR:jcu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105641783  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105641783   Macropinocytosis    Ras GTPases     105641783  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105641783 Exosome [BR:jcu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105641783   Exosomal proteins of other body fluids (saliva and urine)    105641783   Exosomal proteins of colorectal cancer cells    105641783   Exosomal proteins of bladder cancer cells    105641783 GTP-binding proteins [BR:jcu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105641783 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  105641783 NCBI-ProteinID:  XP_012081772 UniProt:  A0A067KBN0 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKAQKTCSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttctaggttcattaaatgcgtcacagttggtgatggtgctgttggcaagact tgcatgctcatctcctacaccagcaacacttttcctactgactatgtgcctactgtgttt gacaacttcagtgcgaatgtggttgtggatgggagcacagtcaatctagggttgtgggat actgctggccaggaagattataatagattaagacctttgagctatcgtggggctgatgtt ttcttgcttgctttctctctcattagcaaggccagttatgaaaatgttgcaaagaagtgg attcctgaattgaggcattatgcacctggagtaccaattatccttgttgggactaagctt gatctccgagatgataagcaattcttcatagatcaccctggtgcagtgcccatcaccaca gctcagggggaggaactgagaaagctaattggagctcctgtttacattgagtgtagttct aaaactcagcagaatgtgaaagcagtctttgatgcagccattaaagtggttctccagcca ccaaaacagaagaagaaaaagaaaaggaaggcacaaaagacatgctccatattgtga

DBGET integrated database retrieval system