KEGG   Jatropha curcas (Barbados nut): 105646167
Entry
105646167         CDS       T03922                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
jcu  Jatropha curcas (Barbados nut)
Pathway
jcu03083  Polycomb repressive complex
jcu04120  Ubiquitin mediated proteolysis
jcu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105646167
   04120 Ubiquitin mediated proteolysis
    105646167
  09126 Chromosome
   03083 Polycomb repressive complex
    105646167
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:jcu04131]
    105646167
   04121 Ubiquitin system [BR:jcu04121]
    105646167
   03036 Chromosome and associated proteins [BR:jcu03036]
    105646167
Membrane trafficking [BR:jcu04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    105646167
Ubiquitin system [BR:jcu04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     105646167
   Cul7 complex
     105646167
Chromosome and associated proteins [BR:jcu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     105646167
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     105646167
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 105646167
NCBI-ProteinID: XP_012087360
UniProt: A0A067JME9
LinkDB
Position
Unknown
AA seq 175 aa
MASTNANNSESATDAPTKKITLKTADDHFFEVEESVAMEFATVKTFFDDNTETMNGTVIP
LPNVSAEYLSKIITYCREHLKFRAESVPEKERKAYDDNFVKELSNEKLREMILASNYLNI
RTLLDVLNQAAADLIQNKSVEFVREFFGVENDFTPEEEERLRQENAWAFEGVDQD
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcttccaccaacgctaacaattctgaatctgctaccgatgccccaactaagaaaatc
accctcaagactgccgacgaccacttcttcgaggtcgaggagtccgtcgcaatggaattc
gccaccgtgaaaacttttttcgacgataatactgagacaatgaacggcactgtgattccg
ctgccgaacgtatccgcggaatatctctccaaaattatcacctactgcagagaacatttg
aagttccgtgcagaatcggtgccagagaaagaaaggaaggcttatgacgataacttcgtc
aaggaattgagcaacgaaaagctcagagagatgatactggctagtaattatctgaatatt
aggactttgctggatgtgcttaatcaggccgcggctgatctgatccagaacaagagcgtc
gagtttgtgagagaattttttggggttgagaatgatttcacaccggaagaggaggaaagg
ctccgccaggagaatgcatgggcttttgagggtgttgatcaggactga

DBGET integrated database retrieval system