Jatropha curcas (Barbados nut): 105650034 Help Entry 105650034         CDS       T03922                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism jcu  Jatropha curcas (Barbados nut) Pathway jcu03018   RNA degradation jcu03040   Spliceosome Brite KEGG Orthology (KO) [BR:jcu00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     105650034   09123 Folding, sorting and degradation    03018 RNA degradation     105650034  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:jcu03019]     105650034    03041 Spliceosome [BR:jcu03041]     105650034 Messenger RNA biogenesis [BR:jcu03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      105650034   mRNA degradation factors    5'-3' decay     Lsm complex      105650034 Spliceosome [BR:jcu03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     105650034  Complex C   U2 snRNP components     105650034 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  105650034 NCBI-ProteinID:  XP_012092296 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPEGVDIDLLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctgttcttttcgtatttcaaggacttggtgggtagagaagtgaccgtggagctcaag aatgatttggcaattagaggaacgctccattctgttgatcagtacctcaatatcaagctc gagaatactcgggttgttgatcaagacaagtaccctcacatgctttcagtgaggaattgt ttcatcaggggatccgtggttagatacgttcaattgcctccagaaggtgttgacatcgat ctgcttcatgacgcaacaagaagagaagctcggggtggctga

DBGET integrated database retrieval system