Jeotgalibaca sp. PTS2502: BW721_04275 Help Entry BW721_04275       CDS       T04689                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jep  Jeotgalibaca sp. PTS2502 Pathway jep01100   Metabolic pathways jep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BW721_04275    00074 Mycolic acid biosynthesis     BW721_04275   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BW721_04275 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Guanylate_cyc Motif Other DBs NCBI-ProteinID:  APZ48959 LinkDB All DBs Position complement(876387..876626) Genome browser AA seq 79 aa AA seqDB search MTENSTFTKISQMIIERFGVDEEKVTRELKFQEDLGADSLDVVELIMEMEDVFGIQISDE DAEKITTIGDAVDYIDGNQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt ttgactgagaacagtacttttacaaagatttcccaaatgattatcgaacgttttggcgtt gatgaggaaaaagtaacgcgtgaattaaagttccaagaagacttaggagctgattcatta gatgtcgttgagttgattatggaaatggaagacgtttttggcatccagatttccgatgaa gatgctgagaaaataaccacaattggcgacgctgttgattatatcgacggtaatcaatag

DBGET integrated database retrieval system