Jeongeupia sp. HS-3: JHS3_31300 Help Entry JHS3_31300        CDS       T08604                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jes  Jeongeupia sp. HS-3 Pathway jes01100   Metabolic pathways jes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JHS3_31300    00074 Mycolic acid biosynthesis     JHS3_31300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JHS3_31300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCL77394 UniProt:  A0A7I8EGW2 LinkDB All DBs Position complement(3323888..3324148) Genome browser AA seq 86 aa AA seqDB search MSDLIIEIKALIIESLNLEDLTPGDIDSDAPLFVDGLGLDSIDALELGVALQKRYGLSLS AESDETRKHFGSVASLAAFVAANRSR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtccgatctgattattgaaatcaaggcactcattatcgagagcctcaacctcgaagac ctcacccccggcgacatcgatagcgatgcgccgctgttcgtcgatggcctgggcctcgat tcgatcgacgcgctggagctgggtgttgcgctgcaaaagcgttacggcctgtcgctgtcg gccgaatcggacgaaacccgcaaacacttcggctcggttgcgagcctcgccgccttcgtt gcggccaaccgcagcaggtaa

DBGET integrated database retrieval system