KEGG   Candidatus Jettenia sp.: L3J17_08080
Entry
L3J17_08080       CDS       T07848                                 
Name
(GenBank) hydrazine oxidoreductase HzoA
  KO
K20935  hydrazine dehydrogenase [EC:1.7.2.8]
Organism
jet  Candidatus Jettenia sp.
Pathway
jet00910  Nitrogen metabolism
jet01100  Metabolic pathways
jet01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jet00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    L3J17_08080
Enzymes [BR:jet01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.8  hydrazine dehydrogenase
     L3J17_08080
SSDB
Motif
Pfam: Multi-haem_cyto Cytochrom_c3_2
Other DBs
NCBI-ProteinID: UJS19046
LinkDB
Position
complement(1870154..1871860)
AA seq 568 aa
MRNFLKVTLMSALIGCGAMGAASSLMLKEAKAVEIITHWVPHEVYGQIGEPDNNGKVFFS
GLGAKYMGYPKHENPPPYPGKYSKFWRTLPAYRYYIPDFMYNRDEVRPSNPIKGTFQLEQ
CIACHSVMTPGIVRDYKKSAHSRAEPNPTGCDTCHGNNHQKLTMPSSKACGTSECHETQY
SEQGQGGIGSHASCSSFAQIECAWSIERPPGDTAGCTFCHTSSEERCSTCHQRHQFDPKV
ARRAEQCKTCHWGKDHRDWEAYDIGLHGVVYQVNKWDPKQFDWDKKLADADYVGPTCQYC
HMRGGHHNVQRFSTVYTSMGMSMADRGAPIWKEKRDRWASVCDDCHSPRFAKENLQALDE
SVKDAGLKYRETFKVAEDLLKDGVADPMPKDLAPDWSGQHIWSLKIGAYHDGPEYGGKTG
ESGEFRMSNCSDIERLCFESVGYFQTYIYKGMAHGSWNDATYSDGSFGMDRWLVNVKQNA
SQARRLAALEKKVGISWVPESFWKTGEWLDQLTGPYIVKNHPGKTIFDLCPDPGWLDTHH
APAEEVEYINRKLDELGMKHESHGGAHH
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgcgtaattttctaaaagtaacattaatgtcagcattaataggttgcggggcgatggga
gccgcatccagtctcatgctgaaagaagcaaaggcagtagaaattattacccactgggta
cctcatgaagtatatggacagatcggtgaaccggataacaacggtaaggtgttcttctct
ggtttaggtgcaaaatatatgggatatccaaaacatgagaatccaccaccctatcctggc
aaatacagcaaattctggagaaccttgccagcataccgttactatatccctgactttatg
tacaacagggatgaagtaagaccttcaaacccgataaagggtaccttccaactcgagcag
tgtattgcgtgtcactcagttatgactcccggtatcgtaagggattataagaagagtgct
cactccagggctgaaccaaacccaacaggctgtgatacctgtcatggtaataaccatcag
aagcttaccatgccatcatcaaaggcttgtggtaccagtgaatgccatgaaacccaatat
agcgaacagggtcagggcggtatcggttcacatgcatcgtgttcaagctttgctcagatt
gaatgtgcatggtcaattgaaagaccaccaggtgacactgccggttgcactttctgccat
accagttcagaagaaagatgcagcacatgccatcagagacatcagtttgatccaaaggtt
gcaagacgtgcagagcagtgcaagacatgccattggggtaaggatcacagagactgggag
gcatatgatatcggtttgcatggggtagtctatcaggtaaacaaatgggatccaaagcag
ttcgattgggataagaagttggccgatgcagattatgttggtccgacatgtcagtattgc
catatgaggggtggtcatcacaacgtacagaggttcagtaccgtatataccagtatgggt
atgtcgatggctgatcgtggagcaccgatatggaaagagaagagagaccgttgggcatcg
gtgtgtgacgattgtcattcaccaaggtttgcgaaagaaaacttgcaagcgttggatgaa
tcggttaaggatgctggtctgaagtatcgtgagacctttaaagttgcagaagacctcctg
aaggatggagtagctgatccgatgccaaaagatcttgcacctgactggtcaggtcagcat
atctggagtttgaagatcggtgcctatcatgatggtccagaatatggtggcaagacgggt
gagtctggagagttcaggatgtcgaactgttcagatatagaaaggctctgctttgagagc
gtagggtatttccagacgtatatctataagggtatggcacatggttcatggaacgatgcg
acgtactcagatggttcattcggtatggatcgttggttagtgaacgtaaagcagaatgct
tctcaggcaaggagacttgcagcattggagaagaaggttggcatcagttgggttccggag
agtttctggaagacaggtgaatggcttgatcagttaacgggtccgtacatcgtgaagaat
catccggggaagaccatcttcgatctgtgtcctgatccaggttggttagatactcatcat
gcacctgctgaagaggttgagtacatcaacaggaagctcgatgaactcggcatgaaacat
gaatcacatggcggcgctcatcactaa

DBGET integrated database retrieval system