Janthinobacterium lividum: G3257_20585 Help Entry G3257_20585       CDS       T06723                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jlv  Janthinobacterium lividum Pathway jlv01100   Metabolic pathways jlv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jlv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G3257_20585 (acpP)    00074 Mycolic acid biosynthesis     G3257_20585 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G3257_20585 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  QKY04408 LinkDB All DBs Position complement(4624849..4625088) Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKIESSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcggatatcgaacaacgcgttaagaaaatcgtcgctgagcaactgggcgttgcagaa gcagacatcaaaatcgaatcctccttcgtcgacgatctcggcgccgattccctggacacc gtggaactggtcatggccctggaagacgaattcgaaatggaaatccctgacgaacaagct gaaaaaatcaccaccgtgcaacaggcgatcgactacgccactgcacacgtcaaggcctaa

DBGET integrated database retrieval system