Juglans regia (English walnut): 108979209 Help Entry 108979209         CDS       T05245                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism jre  Juglans regia (English walnut) Pathway jre04016   MAPK signaling pathway - plant jre04070   Phosphatidylinositol signaling system jre04075   Plant hormone signal transduction jre04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:jre00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     108979209    04070 Phosphatidylinositol signaling system     108979209    04075 Plant hormone signal transduction     108979209  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     108979209  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:jre01009]     108979209   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jre04131]     108979209    03036 Chromosome and associated proteins [BR:jre03036]     108979209   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:jre04147]     108979209 Protein phosphatases and associated proteins [BR:jre01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      108979209 Membrane trafficking [BR:jre04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     108979209 Chromosome and associated proteins [BR:jre03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      108979209 Exosome [BR:jre04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108979209 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C UPF0154 DUF5580_M EFhand_Ca_insen EF-hand_11 Dockerin_1 Caleosin RNA_pol_Rpb4 SurA_N_3 TerB FCaBP_EF-hand SPEF2_C SurA_N_2 GIP1_N DUF6279 MecA_N MotA_activ Fe_hyd_lg_C PA_Ig-like PhageMin_Tail DUF2267 YtzH Arc_PepC Motif Other DBs NCBI-GeneID:  108979209 NCBI-ProteinID:  XP_018805385 UniProt:  A0A2I4DE08 A0A833XPQ7 LinkDB All DBs Position 6:33493184..33496422 Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADH NGTIDFSEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAAELRHVMTNLGEKLTDE EVDEMIREADMDGDGQVNYEEFVRMMLAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggagcagcttacggaggagcagatcgctgagttcaaggaagccttcagcctcttc gacaaggacggcgatggctgcatcactacgaaagagttgggaacagtcatgagatctttg ggacaaaatcctactgaagctgaactgcaggatatgatcaatgaagttgatgctgatcat aatggcacaattgatttctctgagtttctgaatttgatggcacggaaaatgaaggatacc gattctgaggaggaactcaaagaagctttcaaggtgtttgacaaggatcagaatggctat atttctgctgcagagcttcggcatgtgatgaccaatcttggagaaaagctgacagatgaa gaagtggatgagatgatacgagaagcagatatggacggtgatggtcaggtgaattatgag gaatttgtgaggatgatgcttgcaaagtga

DBGET integrated database retrieval system