Juglans regia (English walnut): 108990123 Help Entry 108990123         CDS       T05245                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism jre  Juglans regia (English walnut) Brite KEGG Orthology (KO) [BR:jre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:jre03041]     108990123   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:jre04052]     108990123 Spliceosome [BR:jre03041]  Complex B   Other components    Complex B specific factors     108990123 Cytokines and neuropeptides [BR:jre04052]  Neuropeptides   Unclassified    108990123 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Motif Other DBs NCBI-GeneID:  108990123 NCBI-ProteinID:  XP_018819536 UniProt:  A0A2I4EJG3 LinkDB All DBs Position 14:12750229..12752704 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggtgctcaacgatcgcctcggcaagaaggttcgtgttaagtgcaacgac gacgataccatcggtgacctcaagaagctcgtcgccgctcagaccggcacccgtgccgac aagatccgtatccagaagtggtataacatctacaaggaccacatcacccttaaggactac gagatccacgacggcatgggcctcgagctctactacaattga

DBGET integrated database retrieval system