Juglans regia (English walnut): 108992563 Help Entry 108992563         CDS       T05245                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism jre  Juglans regia (English walnut) Pathway jre04016   MAPK signaling pathway - plant jre04070   Phosphatidylinositol signaling system jre04075   Plant hormone signal transduction jre04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:jre00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     108992563    04070 Phosphatidylinositol signaling system     108992563    04075 Plant hormone signal transduction     108992563  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     108992563  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:jre01009]     108992563   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jre04131]     108992563    03036 Chromosome and associated proteins [BR:jre03036]     108992563   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:jre04147]     108992563 Protein phosphatases and associated proteins [BR:jre01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      108992563 Membrane trafficking [BR:jre04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     108992563 Chromosome and associated proteins [BR:jre03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      108992563 Exosome [BR:jre04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108992563 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  108992563 NCBI-ProteinID:  XP_018822698 UniProt:  A0A833XX61 A0A2I4ETG5 LinkDB All DBs Position 7:complement(47710454..47712553) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccaactcaccgatgaccagatctctgagttcaaggaggccttcagcttgttc gacaaggatggcgacggttgcatcactaccaaggagcttgggactgtgatgaggtcgctc ggccagaacccaactgaagcagagctccaggacatgatcaatgaggttgatgccgatggc aatgggaccattgacttccctgagttcctaaacctcatggccaggaagatgaaagacact gactcagaggaggagcttaaagaggccttccgggtttttgacaaggatcagaatgggttc atctctgctgctgaactgcgccatgtgatgaccaatcttggggagaagctcactgatgag gaagtcgatgagatgatcagggaggctgatgtagatggtgatggccagataaactatgag gagtttgtcaaggtgatgatggccaagtga

DBGET integrated database retrieval system